PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10021434m
Common NameCARUB_v10021434mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 241aa    MW: 27575.8 Da    PI: 9.7165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10021434mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.1e-19449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
  Carubv10021434m  4 RGHWRPAEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding60.53.5e-195699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Carubv10021434m 56 RNPFTEEEEERLLAAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.673150IPR017930Myb domain
SMARTSM007171.1E-15352IPR001005SANT/Myb domain
PfamPF002491.9E-17449IPR001005SANT/Myb domain
SuperFamilySSF466893.48E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-27557IPR009057Homeodomain-like
CDDcd001675.17E-15748No hitNo description
PROSITE profilePS5129426.37951105IPR017930Myb domain
SMARTSM007171.9E-1655103IPR001005SANT/Myb domain
PfamPF002497.9E-165698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2158104IPR009057Homeodomain-like
CDDcd001678.67E-86798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLKDLVE QYGPHNWNAI ALKLPGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLAA HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRTRQTSK PRLLPSTTSS  120
SSLMASEQIM MSSGGYHINN NSRDPKSVLG DVIKFPYQFS HINHLQFLKE FFTGKIALNA  180
KANQSKPMEF YNFLQVNTDS SNKSEIIDQD SDQSNPNDSD NNNESRVPFF DFLSVGNSAS  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-3211051105C-Myb DNA-Binding Domain
1msf_C4e-3211051105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274020.0AK227402.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-06-B21.
GenBankAY5195690.0AY519569.1 Arabidopsis thaliana MYB transcription factor (At1g73410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301042.10.0hypothetical protein CARUB_v10021434mg
TrEMBLR0I7A10.0R0I7A1_9BRAS; Uncharacterized protein
STRINGBra015992.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.11e-129myb domain protein 54